Lineage for d6brfe_ (6brf E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339505Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2339704Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2339705Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2339706Protein Stathmin 4 [101496] (2 species)
  7. 3053815Species Homo sapiens [TaxId:9606] [353877] (3 PDB entries)
  8. 3053895Domain d6brfe_: 6brf E: [353957]
    Other proteins in same PDB: d6brfa1, d6brfa2, d6brfb1, d6brfb2, d6brfc1, d6brfc2, d6brfd1, d6brfd2, d6brff1, d6brff2, d6brff3
    automated match to d4i55e_
    complexed with acp, ca, e44, gdp, gtp, mes, mg

Details for d6brfe_

PDB Entry: 6brf (more details), 2.5 Å

PDB Description: tubulin-rb3_sld-ttl in complex with heterocyclic pyrimidine compound 4b
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d6brfe_:

Sequence, based on SEQRES records: (download)

>d6brfe_ a.137.10.1 (E:) Stathmin 4 {Homo sapiens [TaxId: 9606]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d6brfe_ a.137.10.1 (E:) Stathmin 4 {Homo sapiens [TaxId: 9606]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d6brfe_:

Click to download the PDB-style file with coordinates for d6brfe_.
(The format of our PDB-style files is described here.)

Timeline for d6brfe_:

  • d6brfe_ appears in periodic updates to SCOPe 2.07 starting on 2018-06-28