Lineage for d1b0ja2 (1b0j A:2-528)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141742Fold c.83: Aconitase iron-sulfur domain [53731] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2141743Superfamily c.83.1: Aconitase iron-sulfur domain [53732] (1 family) (S)
  5. 2141744Family c.83.1.1: Aconitase iron-sulfur domain [53733] (4 protein domains)
    duplication: consists of three structurally similar subdomains with subdomains 1 and 3 being related by pseudo twofold symmetry
  6. 2141745Protein Aconitase A, N-terminal domain [53734] (2 species)
  7. 2141756Species Pig (Sus scrofa) [TaxId:9823] [53735] (6 PDB entries)
  8. 2141759Domain d1b0ja2: 1b0j A:2-528 [35395]
    Other proteins in same PDB: d1b0ja1
    complexed with ict, sf4

Details for d1b0ja2

PDB Entry: 1b0j (more details), 2.5 Å

PDB Description: crystal structure of aconitase with isocitrate
PDB Compounds: (A:) aconitate hydratase

SCOPe Domain Sequences for d1b0ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0ja2 c.83.1.1 (A:2-528) Aconitase A, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
rakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkty
lrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdinq
evynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicigv
ggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaiveyh
gpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlvp
dpgchydqvieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctns
syedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlanac
gpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkfn
petdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqr

SCOPe Domain Coordinates for d1b0ja2:

Click to download the PDB-style file with coordinates for d1b0ja2.
(The format of our PDB-style files is described here.)

Timeline for d1b0ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b0ja1