Lineage for d6g3zb_ (6g3z B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2420459Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2420460Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2420461Protein 2-keto-3-deoxy gluconate aldolase Eda [110360] (1 species)
  7. 2420462Species Sulfolobus solfataricus [TaxId:2287] [110361] (5 PDB entries)
    Uniprot Q97U28
  8. 3053873Domain d6g3zb_: 6g3z B: [353935]
    automated match to d1w3ta_
    complexed with ele, ipa

Details for d6g3zb_

PDB Entry: 6g3z (more details), 2.35 Å

PDB Description: sulfolobus sulfataricus 2-keto-3-deoxygluconate (kdg) aldolase complex with d-kdpg
PDB Compounds: (B:) 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase

SCOPe Domain Sequences for d6g3zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g3zb_ c.1.10.1 (B:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]}
peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke

SCOPe Domain Coordinates for d6g3zb_:

Click to download the PDB-style file with coordinates for d6g3zb_.
(The format of our PDB-style files is described here.)

Timeline for d6g3zb_:

  • d6g3zb_ appears in periodic updates to SCOPe 2.07 starting on 2018-06-28