Lineage for d6fc0a1 (6fc0 A:35-250)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962762Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2962763Protein automated matches [190708] (10 species)
    not a true protein
  7. 2962771Species Chaetomium thermophilum [TaxId:759272] [353919] (2 PDB entries)
  8. 2962772Domain d6fc0a1: 6fc0 A:35-250 [353923]
    Other proteins in same PDB: d6fc0a2
    automated match to d4tpwa_

Details for d6fc0a1

PDB Entry: 6fc0 (more details), 1.29 Å

PDB Description: crystal structure of the eif4e-eif4g complex from chaetomium thermophilum
PDB Compounds: (A:) Eukaryotic translation initiation factor 4E-like protein

SCOPe Domain Sequences for d6fc0a1:

Sequence, based on SEQRES records: (download)

>d6fc0a1 d.86.1.0 (A:35-250) automated matches {Chaetomium thermophilum [TaxId: 759272]}
tvfhdkenfnvkhplscrwtlwftkpasgkgdnwndllkkvitfesveefwgiynniapv
selavksdyhlfkegvrpewedpqnkhggkwayqfkdkrsvnidelwlhtmlaaigetle
deedgevmgvvvnvrkgfyrigvwtrttekskeilmnigrrlkevlklppnemvefsght
eaaqagstrakarmvv

Sequence, based on observed residues (ATOM records): (download)

>d6fc0a1 d.86.1.0 (A:35-250) automated matches {Chaetomium thermophilum [TaxId: 759272]}
tvfhdkenfnvkhplscrwtlwftkpasgkgdnwndllkkvitfesveefwgiynniapv
selavksdyhlfkegvrpewedpqnkhggkwayqfkdkrsvnidelwlhtmlaaigetle
deedgevmgvvvnvrkgfyrigvwtrttekeilmnigrrlkevlklppnemvefsghtea
aqagrmvv

SCOPe Domain Coordinates for d6fc0a1:

Click to download the PDB-style file with coordinates for d6fc0a1.
(The format of our PDB-style files is described here.)

Timeline for d6fc0a1: