Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.86: eIF4e-like [55417] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478 |
Superfamily d.86.1: eIF4e-like [55418] (3 families) |
Family d.86.1.0: automated matches [191459] (1 protein) not a true family |
Protein automated matches [190708] (10 species) not a true protein |
Species Chaetomium thermophilum [TaxId:759272] [353919] (2 PDB entries) |
Domain d6fc0a1: 6fc0 A:35-250 [353923] Other proteins in same PDB: d6fc0a2 automated match to d4tpwa_ |
PDB Entry: 6fc0 (more details), 1.29 Å
SCOPe Domain Sequences for d6fc0a1:
Sequence, based on SEQRES records: (download)
>d6fc0a1 d.86.1.0 (A:35-250) automated matches {Chaetomium thermophilum [TaxId: 759272]} tvfhdkenfnvkhplscrwtlwftkpasgkgdnwndllkkvitfesveefwgiynniapv selavksdyhlfkegvrpewedpqnkhggkwayqfkdkrsvnidelwlhtmlaaigetle deedgevmgvvvnvrkgfyrigvwtrttekskeilmnigrrlkevlklppnemvefsght eaaqagstrakarmvv
>d6fc0a1 d.86.1.0 (A:35-250) automated matches {Chaetomium thermophilum [TaxId: 759272]} tvfhdkenfnvkhplscrwtlwftkpasgkgdnwndllkkvitfesveefwgiynniapv selavksdyhlfkegvrpewedpqnkhggkwayqfkdkrsvnidelwlhtmlaaigetle deedgevmgvvvnvrkgfyrigvwtrttekeilmnigrrlkevlklppnemvefsghtea aqagrmvv
Timeline for d6fc0a1: