SCOPe 2.08: Domain d6fbza1: 6fbz A:35-250

Lineage for d6fbza1 (6fbz A:35-250)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (3 families)

5. Family d.86.1.0: automated matches [191459] (1 protein)
   not a true family

6. Protein automated matches [190708] (10 species)
   not a true protein

7. Species Chaetomium thermophilum [TaxId:759272] [353919] (2 PDB entries)

8. Domain d6fbza1: 6fbz A:35-250 [353920]
   Other proteins in same PDB: d6fbza2
   automated match to d4tpwa_
   complexed with mgp

Details for d6fbza1

PDB Entry: 6fbz, 1.5 Å

PDB Description: crystal structure of the eif4e-eif4g complex from chaetomium thermophilum in the cap-bound state

PDB Compounds: (A:) Eukaryotic translation initiation factor 4E-like protein,Eukaryotic translation initiation factor 4E-like protein

SCOPe Domain Sequences for d6fbza1:

Sequence, based on SEQRES records:

>d6fbza1 d.86.1.0 (A:35-250) automated matches {Chaetomium thermophilum [TaxId: 759272]}
tvfhdkenfnvkhplscrwtlwftkpasgkgdnwndllkkvitfesveefwgiynniapv
selavksdyhlfkegvrpewedpqnkhggkwayqfkdkrsvnidelwlhtmlaaigetle
deedgevmgvvvnvrkgfyrigvwtrttekskeilmnigrrlkevlklppnemvefsght
eaaqagstrakarmvv

Sequence, based on observed residues (ATOM records):

>d6fbza1 d.86.1.0 (A:35-250) automated matches {Chaetomium thermophilum [TaxId: 759272]}
tvfhdkenfnvkhplscrwtlwftkpasgkgdnwndllkkvitfesveefwgiynniapv
selavksdyhlfkegvrpewedpqnkhggkwayqfkdkrsvnidelwlhtmlaaigetle
deedgevmgvvvnvrkgfyrigvwtrttekskeilmnigrrlkevlklppnemvefsght
eaaqamvv

Timeline for d6fbza1:

• d6fbza1 first appeared in SCOPe 2.07