SCOPe 2.08: Domain d6fc2a1: 6fc2 A:35-213

Lineage for d6fc2a1 (6fc2 A:35-213)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (3 families)

5. Family d.86.1.0: automated matches [191459] (1 protein)
   not a true family

6. Protein automated matches [190708] (10 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [353895] (2 PDB entries)

8. Domain d6fc2a1: 6fc2 A:35-213 [353906]
   Other proteins in same PDB: d6fc2a2
   automated match to d3m94a_
   complexed with ca

Details for d6fc2a1

PDB Entry: 6fc2, 1.92 Å

PDB Description: crystal structure of the eif4e-eap1p complex from saccharomyces cerevisiae

PDB Compounds: (A:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d6fc2a1:

Sequence, based on SEQRES records:

>d6fc2a1 d.86.1.0 (A:35-213) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
vkhplntawtlwytkpavdkseswsdllrpvtsfqtveefwaiiqnipephelplksdyh
vfrndvrpewedeanakggkwsfqlrgkgadidelwlrtllavigetideddsqingvvl
sirkggnkfalwtasedkepllriggkfkqvlaltddghleffphssangrhpqpsitl

Sequence, based on observed residues (ATOM records):

>d6fc2a1 d.86.1.0 (A:35-213) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
vkhplntawtlwytkpavdkseswsdllrpvtsfqtveefwaiiqnipephelplksdyh
vfrndvrpewedeanakggkwsfqlrgkgadidelwlrtllavigetideddsqingvvl
sirkggnkfalwtasedkepllriggkfkqvlaltddghleffphsspqpsitl

Timeline for d6fc2a1:

• d6fc2a1 first appeared in SCOPe 2.07