Lineage for d6dt4b1 (6dt4 B:9-138)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2405483Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2405489Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2405640Protein automated matches [190352] (9 species)
    not a true protein
  7. 3053840Species Yersinia pestis [TaxId:214092] [353902] (1 PDB entry)
  8. 3053841Domain d6dt4b1: 6dt4 B:9-138 [353903]
    Other proteins in same PDB: d6dt4a2, d6dt4b2
    automated match to d4i02b1
    protein/DNA complex; complexed with cl, cmp

Details for d6dt4b1

PDB Entry: 6dt4 (more details), 1.8 Å

PDB Description: 1.8 angstrom resolution crystal structure of camp-regulatory protein from yersinia pestis in complex with camp
PDB Compounds: (B:) Cyclic AMP receptor protein

SCOPe Domain Sequences for d6dt4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dt4b1 b.82.3.2 (B:9-138) automated matches {Yersinia pestis [TaxId: 214092]}
dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlssqmanrlqit
sekvgnlafl

SCOPe Domain Coordinates for d6dt4b1:

Click to download the PDB-style file with coordinates for d6dt4b1.
(The format of our PDB-style files is described here.)

Timeline for d6dt4b1:

  • d6dt4b1 appears in periodic updates to SCOPe 2.07 starting on 2018-06-28

View in 3D
Domains from same chain:
(mouse over for more information)
d6dt4b2