Lineage for d6eicc_ (6eic C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (124 species)
    not a true protein
  7. 2476949Species Mycobacterium tuberculosis [TaxId:83332] [189096] (10 PDB entries)
  8. 3053829Domain d6eicc_: 6eic C: [353891]
    automated match to d4zxfc_
    complexed with mpd, no3, so4

Details for d6eicc_

PDB Entry: 6eic (more details), 1.8 Å

PDB Description: crystal strukture of rv0183, a monoglyceride lipase from mycobacterium tuberculosis
PDB Compounds: (C:) Mycobacterium Tuberculosis Monoglyceride Lipase

SCOPe Domain Sequences for d6eicc_:

Sequence, based on SEQRES records: (download)

>d6eicc_ c.69.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mtttrternfagigdvrivydvwtpdtapqavvvlahglgeharrydhvaqrlgaaglvt
yaldhrghgrsggkrvlvrdiseytadfdtlvgiatreypgckrivlghsmgggivfayg
verpdnydlmvlsapavaaqdlvspvvavaakllgvvvpglpvqeldftaisrdpevvqa
yntdplvhhgrvpagigrallqvgetmprrapaltapllvlhgtddrlipiegsrrlvec
vgsadvqlkeypglyhevfnepernqvlddvvawlterl

Sequence, based on observed residues (ATOM records): (download)

>d6eicc_ c.69.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mtttrternfagigdvrivydvwtpdtapqavvvlahglgeharrydhvaqrlgaaglvt
yaldhrghgrsggkrvlvrdiseytadfdtlvgiatreypgckrivlghsmgggivfayg
verpdnydlmvlsapavaaspvvavaakllgvvvpglpvqeldftaisrdpevvqayntd
plvhhgrvpagigrallqvgetmprrapaltapllvlhgtddrlipiegsrrlvecvgsa
dvqlkeypglyhevfnepernqvlddvvawlterl

SCOPe Domain Coordinates for d6eicc_:

Click to download the PDB-style file with coordinates for d6eicc_.
(The format of our PDB-style files is described here.)

Timeline for d6eicc_:

  • d6eicc_ is new in SCOPe 2.07-stable