Lineage for d6cr2a1 (6cr2 A:51-518)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. Protein automated matches [190847] (97 species)
    not a true protein
  7. Species Aspergillus fumigatus [TaxId:330879] [353881] (1 PDB entry)
  8. Domain d6cr2a1: 6cr2 A:51-518 [353884]
    Other proteins in same PDB: d6cr2a2, d6cr2b2
    automated match to d3zg2a_
    complexed with hem, lfv

Details for d6cr2a1

PDB Entry: 6cr2 (more details), 2.38 Å

PDB Description: crystal structure of sterol 14-alpha demethylase (cyp51b) from aspergillus fumigatus in complex with the vni derivative n-(1-(2,4- dichlorophenyl)-2-(1h-imidazol-1-yl)ethyl)-4-(5-(2-fluoro-4-(2,2,2- trifluoroethoxy)phenyl)-1,3,4-oxadiazol-2-yl)benzamide
PDB Compounds: (A:) 14-alpha sterol demethylase Cyp51B

SCOPe Domain Sequences for d6cr2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cr2a1 a.104.1.0 (A:51-518) automated matches {Aspergillus fumigatus [TaxId: 330879]}
tppvvfhwfpfigstisygidpykfffdcrakygdiftfillgkkttvylgtkgndfiln
gklrdvcaeevysplttpvfgrhvvydcpnaklmeqkkfvkygltsdalrsyvplitdev
esfvknspafqghkgvfdvcktiaeitiytasrslqgkevrskfdstfaelyhnldmgfa
pinfmlpwaplphnrkrdaaqrkltetymeiikarrqagskkdsedmvwnlmscvykngt
pvpdeeiahmmiallmagqhsssstaswivlrlatrpdimeelyqeqirvlgsdlpplty
dnlqkldlhakviketlrlhapihsiiravknpmavdgtsyviptshnvlsspgvtarse
ehfpnplewnphrwdeniaasaeddekvdygyglvskgtnspylpfgagrhrcigeqfay
lqlgtitavlvrlfrfrnlpgvdgipdtdysslfskplgrsfvefekr

SCOPe Domain Coordinates for d6cr2a1 are not available.

Timeline for d6cr2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6cr2a2
View in 3D
Domains from other chains:
(mouse over for more information)
d6cr2b1, d6cr2b2