Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (95 species) not a true protein |
Species Aspergillus fumigatus [TaxId:330879] [353881] (1 PDB entry) |
Domain d6cr2b1: 6cr2 B:51-518 [353882] Other proteins in same PDB: d6cr2a2, d6cr2b2 automated match to d3zg2a_ complexed with hem, lfv |
PDB Entry: 6cr2 (more details), 2.38 Å
SCOPe Domain Sequences for d6cr2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cr2b1 a.104.1.0 (B:51-518) automated matches {Aspergillus fumigatus [TaxId: 330879]} tppvvfhwfpfigstisygidpykfffdcrakygdiftfillgkkttvylgtkgndfiln gklrdvcaeevysplttpvfgrhvvydcpnaklmeqkkfvkygltsdalrsyvplitdev esfvknspafqghkgvfdvcktiaeitiytasrslqgkevrskfdstfaelyhnldmgfa pinfmlpwaplphnrkrdaaqrkltetymeiikarrqagskkdsedmvwnlmscvykngt pvpdeeiahmmiallmagqhsssstaswivlrlatrpdimeelyqeqirvlgsdlpplty dnlqkldlhakviketlrlhapihsiiravknpmavdgtsyviptshnvlsspgvtarse ehfpnplewnphrwdeniaasaeddekvdygyglvskgtnspylpfgagrhrcigeqfay lqlgtitavlvrlfrfrnlpgvdgipdtdysslfskplgrsfvefekr
Timeline for d6cr2b1: