Lineage for d6ca7l1 (6ca7 L:1-106)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188740] (689 PDB entries)
  8. Domain d6ca7l1: 6ca7 L:1-106 [353871]
    Other proteins in same PDB: d6ca7h_, d6ca7l2
    automated match to d1dn0a1

Details for d6ca7l1

PDB Entry: 6ca7 (more details), 1.6400000000000001 Å

PDB Description: crystal structure of pct64_13c, a strain specific anti-hiv antibody
PDB Compounds: (L:) PCT64_13C light chain

SCOPe Domain Sequences for d6ca7l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ca7l1 b.1.1.1 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqsvsnnylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqsarsftfgpgtkvdi

SCOPe Domain Coordinates for d6ca7l1 are not available.

Timeline for d6ca7l1:

Domains from same chain:
(mouse over for more information)
d6ca7l2
Domains from other chains:
(mouse over for more information)
d6ca7h_