SCOPe 2.07: Domain d6bs2d2: 6bs2 D:244-431

Lineage for d6bs2d2 (6bs2 D:244-431)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries)

8. Domain d6bs2d2: 6bs2 D:244-431 [353862]
   Other proteins in same PDB: d6bs2a1, d6bs2b1, d6bs2c1, d6bs2d1, d6bs2e_, d6bs2f1, d6bs2f2, d6bs2f3
   automated match to d3rycd2
   complexed with acp, ca, e9y, gdp, gtp, mes, mg

Details for d6bs2d2

PDB Entry: 6bs2, 2.65 Å

PDB Description: tubulin-rb3_sld-ttl in complex with heterocyclic pyrimidine compound 8b

PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6bs2d2:

Sequence, based on SEQRES records:

>d6bs2d2 d.79.2.1 (D:244-431) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records):

>d6bs2d2 d.79.2.1 (D:244-431) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv
aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta
iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

Timeline for d6bs2d2:

• d6bs2d2 is new in SCOPe 2.07-stable
  
• d6bs2d2 appears in the current release, SCOPe 2.08