Lineage for d5oxsc2 (5oxs C:235-355)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2558907Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2559296Protein Surfactant protein, lectin domain [56461] (3 species)
  7. 2559297Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (11 PDB entries)
  8. 3053766Domain d5oxsc2: 5oxs C:235-355 [353828]
    Other proteins in same PDB: d5oxsa1, d5oxsb1, d5oxsc1
    automated match to d1pwba1
    complexed with ca, glc, gmh, k5b

Details for d5oxsc2

PDB Entry: 5oxs (more details), 1.65 Å

PDB Description: crystal structure of human lung surfactant protein d trimeric fragment with bound ligand salmonella enterica minnesota r5 oligosaccharide
PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d5oxsc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oxsc2 d.169.1.1 (C:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d5oxsc2:

Click to download the PDB-style file with coordinates for d5oxsc2.
(The format of our PDB-style files is described here.)

Timeline for d5oxsc2:

  • d5oxsc2 is new in SCOPe 2.07-stable