Lineage for d5xt0a3 (5xt0 A:532-677)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. Protein automated matches [226991] (9 species)
    not a true protein
  7. Species Scheffersomyces stipitis [TaxId:322104] [328851] (25 PDB entries)
  8. Domain d5xt0a3: 5xt0 A:532-677 [353825]
    Other proteins in same PDB: d5xt0a1, d5xt0a2
    automated match to d1gpua3
    complexed with ca, peg, t6f

Details for d5xt0a3

PDB Entry: 5xt0 (more details), 1.1500000000000001 Å

PDB Description: crystal structure of transketolase in complex with tpp intermediate viii from pichia stipitis
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d5xt0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xt0a3 c.48.1.0 (A:532-677) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
egssiekaskggytlvqqdkadiiivatgsevslavdalkvlegqgikagvvslpdqltf
dkqseeyklsvlpdgvpilsvevmstfgwskyshqqfglnrfgasgkapeifklfeftpe
gvaeraaktvafykgkdvvsplrsaf

SCOPe Domain Coordinates for d5xt0a3 are not available.

Timeline for d5xt0a3:

Domains from same chain:
(mouse over for more information)
d5xt0a1, d5xt0a2