Lineage for d5xt0a2 (5xt0 A:335-531)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. Protein automated matches [227126] (21 species)
    not a true protein
  7. Species Scheffersomyces stipitis [TaxId:322104] [328848] (25 PDB entries)
  8. Domain d5xt0a2: 5xt0 A:335-531 [353824]
    Other proteins in same PDB: d5xt0a3
    automated match to d1gpua2
    complexed with ca, peg, t6f

Details for d5xt0a2

PDB Entry: 5xt0 (more details), 1.1500000000000001 Å

PDB Description: crystal structure of transketolase in complex with tpp intermediate viii from pichia stipitis
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d5xt0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xt0a2 c.36.1.0 (A:335-531) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
lpenwdkalpvytpadaavatrklseivlskiipevpeiiggsadltpsnltkakgtvdf
qpaatglgdysgryirygvrehamgaimngiaafganyknyggtflnfvsyaagavrlsa
lsefpitwvathdsiglgedgpthqpietlahfratpnisvwrpadgnetsaayksaies
thtphilaltrqnlpql

SCOPe Domain Coordinates for d5xt0a2 are not available.

Timeline for d5xt0a2:

Domains from same chain:
(mouse over for more information)
d5xt0a1, d5xt0a3