Lineage for d5xt4a3 (5xt4 A:532-677)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880614Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2880615Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2880787Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. 2880788Protein automated matches [226991] (9 species)
    not a true protein
  7. 2880841Species Scheffersomyces stipitis [TaxId:322104] [328851] (25 PDB entries)
  8. 2880854Domain d5xt4a3: 5xt4 A:532-677 [353811]
    Other proteins in same PDB: d5xt4a1, d5xt4a2
    automated match to d1gpua3
    complexed with ca, peg, t6f

Details for d5xt4a3

PDB Entry: 5xt4 (more details), 1.06 Å

PDB Description: crystal structure of transketolase in complex with tpp intermediate viii' from pichia stipitis
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d5xt4a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xt4a3 c.48.1.0 (A:532-677) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
egssiekaskggytlvqqdkadiiivatgsevslavdalkvlegqgikagvvslpdqltf
dkqseeyklsvlpdgvpilsvevmstfgwskyshqqfglnrfgasgkapeifklfeftpe
gvaeraaktvafykgkdvvsplrsaf

SCOPe Domain Coordinates for d5xt4a3:

Click to download the PDB-style file with coordinates for d5xt4a3.
(The format of our PDB-style files is described here.)

Timeline for d5xt4a3: