Lineage for d1qi1a_ (1qi1 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27618Fold c.82: Aldehyde reductase (dehydrogenase), ALDH [53719] (1 superfamily)
  4. 27619Superfamily c.82.1: Aldehyde reductase (dehydrogenase), ALDH [53720] (1 family) (S)
  5. 27620Family c.82.1.1: Aldehyde reductase (dehydrogenase), ALDH [53721] (1 protein)
  6. 27621Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (8 species)
  7. 27662Species Streptococcus mutans [TaxId:1309] [53729] (4 PDB entries)
  8. 27675Domain d1qi1a_: 1qi1 A: [35381]

Details for d1qi1a_

PDB Entry: 1qi1 (more details), 3 Å

PDB Description: Ternary Complex of an NADP Dependent Aldehyde Dehydrogenase

SCOP Domain Sequences for d1qi1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qi1a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans}
tkqyknyvngewklseneikiyepasgaelgsvpamsteevdyvyasakkaqpawralsy
ieraaylhkvadilmrdkekigailskevakgyksavsevvrtaeiinyaaeeglrmege
vleggsfeaaskkkiavvrrepvglvlaispfnypvnlagskiapaliagnviafkpptq
gsisglllaeafaeaglpagvfntitgrgseigdyivehqavnfinftgstgigerigkm
agmrpimlelggkdsaivledadleltakniiagafgysgqrstavkrvlvmesvadelv
ekirekvlaltignpeddaditplidtksadyveglindandkgatalteikregnlicp
ilfdkvttdmrlaweepfgpvlpiirvtsveeaieisnkseyglqasiftndfprafgia
eqlevgtvhinnktqrgtdnfpflgakksgagiqgvkysieamttvksvvfdik

SCOP Domain Coordinates for d1qi1a_:

Click to download the PDB-style file with coordinates for d1qi1a_.
(The format of our PDB-style files is described here.)

Timeline for d1qi1a_: