Lineage for d5xskb_ (5xsk B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394294Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. 2394300Protein Hepatoma-derived growth factor, HDGF [117151] (2 species)
  7. 2394303Species Norway rat (Rattus norvegicus) [TaxId:10116] [141211] (2 PDB entries)
    Uniprot Q8VHK7 1-110
  8. 2394305Domain d5xskb_: 5xsk B: [353804]
    automated match to d2b8aa1
    protein/DNA complex; complexed with mpd

Details for d5xskb_

PDB Entry: 5xsk (more details), 2.84 Å

PDB Description: crystal structure of pwwp-dna complex for human hepatoma-derived growth factor
PDB Compounds: (B:) Hepatoma-derived growth factor

SCOPe Domain Sequences for d5xskb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xskb_ b.34.9.2 (B:) Hepatoma-derived growth factor, HDGF {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qkeykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgpkdlfpy
eeskekfgkpnkrkgfseglweiennptvka

SCOPe Domain Coordinates for d5xskb_:

Click to download the PDB-style file with coordinates for d5xskb_.
(The format of our PDB-style files is described here.)

Timeline for d5xskb_: