Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.2: PWWP domain [69250] (6 proteins) includes the C-terminal all-alpha subdomain |
Protein Hepatoma-derived growth factor, HDGF [117151] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [141211] (2 PDB entries) Uniprot Q8VHK7 1-110 |
Domain d5xskb_: 5xsk B: [353804] automated match to d2b8aa1 protein/DNA complex; complexed with mpd |
PDB Entry: 5xsk (more details), 2.84 Å
SCOPe Domain Sequences for d5xskb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xskb_ b.34.9.2 (B:) Hepatoma-derived growth factor, HDGF {Norway rat (Rattus norvegicus) [TaxId: 10116]} qkeykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgpkdlfpy eeskekfgkpnkrkgfseglweiennptvka
Timeline for d5xskb_: