Lineage for d5oxsb1 (5oxs B:203-234)

  1. Root: SCOPe 2.08
  2. Class h: Coiled coil proteins [57942] (7 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. Protein Surfactant protein [57949] (3 species)
  7. Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries)
  8. Domain d5oxsb1: 5oxs B:203-234 [353801]
    Other proteins in same PDB: d5oxsa2, d5oxsb2, d5oxsc2
    automated match to d1pwba2
    complexed with ca

Details for d5oxsb1

PDB Entry: 5oxs (more details), 1.6500000000000001 Å

PDB Description: crystal structure of human lung surfactant protein d trimeric fragment with bound ligand salmonella enterica minnesota r5 oligosaccharide
PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d5oxsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oxsb1 h.1.1.1 (B:203-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
dvaslrqqvealqgqvqhlqaafsqykkvelf

SCOPe Domain Coordinates for d5oxsb1 are not available.

Timeline for d5oxsb1:

Domains from same chain:
(mouse over for more information)
d5oxsb2
Domains from other chains:
(mouse over for more information)
d5oxsa1, d5oxsa2, d5oxsc1, d5oxsc2