SCOPe 2.08: Domain d5oxsb1: 5oxs B:203-234

Lineage for d5oxsb1 (5oxs B:203-234)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family)

5. Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)

6. Protein Surfactant protein [57949] (3 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries)

8. Domain d5oxsb1: 5oxs B:203-234 [353801]
   Other proteins in same PDB: d5oxsa2, d5oxsb2, d5oxsc2
   automated match to d1pwba2
   complexed with ca

Details for d5oxsb1

PDB Entry: 5oxs, 1.65 Å

PDB Description: crystal structure of human lung surfactant protein d trimeric fragment with bound ligand salmonella enterica minnesota r5 oligosaccharide

PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d5oxsb1:

Sequence; same for both SEQRES and ATOM records:

>d5oxsb1 h.1.1.1 (B:203-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
dvaslrqqvealqgqvqhlqaafsqykkvelf

Timeline for d5oxsb1:

• d5oxsb1 first appeared in SCOPe 2.07