Lineage for d5w4qa2 (5w4q A:148-221)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. Protein automated matches [191156] (12 species)
    not a true protein
  7. Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (33 PDB entries)
  8. Domain d5w4qa2: 5w4q A:148-221 [353798]
    Other proteins in same PDB: d5w4qa1
    automated match to d2m8pa2
    complexed with cl, iod; mutant

Details for d5w4qa2

PDB Entry: 5w4q (more details), 2.29 Å

PDB Description: structure of the r18a/e28a mutant of the hiv-1 capsid protein
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d5w4qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w4qa2 a.28.3.0 (A:148-221) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacqgv

SCOPe Domain Coordinates for d5w4qa2 are not available.

Timeline for d5w4qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5w4qa1