Lineage for d5w4qa1 (5w4q A:1-147)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. Protein HIV-1 capsid protein [47945] (1 species)
  7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. Domain d5w4qa1: 5w4q A:1-147 [353797]
    Other proteins in same PDB: d5w4qa2
    automated match to d4xfxa1
    complexed with cl, iod; mutant

Details for d5w4qa1

PDB Entry: 5w4q (more details), 2.29 Å

PDB Description: structure of the r18a/e28a mutant of the hiv-1 capsid protein
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d5w4qa1:

Sequence, based on SEQRES records: (download)

>d5w4qa1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaispatlnawvkvvaekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records): (download)

>d5w4qa1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqgqmvhqaispatlnawvkvvaekafspevipmfsalsegatpqdlntmlntvgghq
aamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnpp
ipvgeiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d5w4qa1 are not available.

Timeline for d5w4qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5w4qa2