Lineage for d5v7da_ (5v7d A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. Protein Phage T4 lysozyme [53982] (1 species)
  7. Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
    Uniprot P00720
    many mutant structures
  8. Domain d5v7da_: 5v7d A: [353791]
    automated match to d4pjza_
    complexed with hed

Details for d5v7da_

PDB Entry: 5v7d (more details), 1.35 Å

PDB Description: t4 lysozyme y18ymbr
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d5v7da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v7da_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkixkdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOPe Domain Coordinates for d5v7da_ are not available.

Timeline for d5v7da_: