Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries) |
Domain d5xkhd2: 5xkh D:244-431 [353771] Other proteins in same PDB: d5xkha1, d5xkhb1, d5xkhc1, d5xkhd1, d5xkhe_, d5xkhf1, d5xkhf2, d5xkhf3 automated match to d3rycd2 complexed with 89c, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 5xkh (more details), 2.25 Å
SCOPe Domain Sequences for d5xkhd2:
Sequence, based on SEQRES records: (download)
>d5xkhd2 d.79.2.1 (D:244-431) automated matches {Pig (Sus scrofa) [TaxId: 9823]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdatad
>d5xkhd2 d.79.2.1 (D:244-431) automated matches {Pig (Sus scrofa) [TaxId: 9823]} gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad
Timeline for d5xkhd2: