Lineage for d5xoea_ (5xoe A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519106Fold c.89: Phosphofructokinase [53783] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest
    Domain 2 has parallel sheet of 4 strands, order 2314
  4. 2519107Superfamily c.89.1: Phosphofructokinase [53784] (2 families) (S)
  5. 2519108Family c.89.1.1: Phosphofructokinase [53785] (3 proteins)
  6. 2519152Protein automated matches [190282] (4 species)
    not a true protein
  7. 2519165Species Staphylococcus aureus [TaxId:273036] [353760] (1 PDB entry)
  8. 2519166Domain d5xoea_: 5xoe A: [353761]
    automated match to d4a3sa_

Details for d5xoea_

PDB Entry: 5xoe (more details), 2.98 Å

PDB Description: crystal structure of the apo staphylococcus aureus phosphofructokinase
PDB Compounds: (A:) ATP-dependent 6-phosphofructokinase

SCOPe Domain Sequences for d5xoea_:

Sequence, based on SEQRES records: (download)

>d5xoea_ c.89.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 273036]}
mkkiavltsggdspgmnaavravvrtaiyneievygvyhgyqgllnddihklelgsvgdt
iqrggtflysarcpefkeqevrkvaienlrkrgieglvviggdgsyrgaqriseeckeiq
tigipgtidndingtdftigfdtalntiiglvdkirdtasshartfiieamgrdcgdlal
waglsvgaetivvpevktdikeiadkieqgikrgkkhsivlvaegcmtaqdcqkelsqyi
nvdnrvsvlghvqrggsptgadrvlasrlggyavdllmqgetakgvgiknnkivatsfde
ifdgkdhkfdyslyelanklsi

Sequence, based on observed residues (ATOM records): (download)

>d5xoea_ c.89.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 273036]}
mkkiavltsggdspgmnaavravvrtaiyneievygvyhgyqgllnddihklelgsvgdt
iqrggtflysarcpefkeqevrkvaienlrkrgieglvviggdgsyrgaqriseeckeiq
tigipgtidndingtdftigfdtalntiiglvdkirdtasshartfiieamgrdcgdlal
waglsvgaetivvpevktdikeiadkieqgikrgkkhsivlvaegcmtaqdcqkelsqyi
nvdnrvsvlghvqrggsptgadrvlasrlggyavdllmqgetakgvgiknnkivatsfde
ifdkfdyslyelanklsi

SCOPe Domain Coordinates for d5xoea_:

Click to download the PDB-style file with coordinates for d5xoea_.
(The format of our PDB-style files is described here.)

Timeline for d5xoea_: