Lineage for d5vetb_ (5vet B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733242Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (39 PDB entries)
    Uniprot P59071
  8. 2733286Domain d5vetb_: 5vet B: [353743]
    automated match to d1tk4a_

Details for d5vetb_

PDB Entry: 5vet (more details), 2 Å

PDB Description: phospholipase a2, re-refinement of the pdb structure 1jq8 without the putative complexed oligopeptide
PDB Compounds: (B:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d5vetb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vetb_ a.133.1.2 (B:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d5vetb_:

Click to download the PDB-style file with coordinates for d5vetb_.
(The format of our PDB-style files is described here.)

Timeline for d5vetb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5veta_