![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) ![]() |
![]() | Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) |
![]() | Protein Surfactant protein [57949] (3 species) |
![]() | Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries) |
![]() | Domain d5oxrc1: 5oxr C:205-234 [353736] Other proteins in same PDB: d5oxra2, d5oxrb2, d5oxrc2 automated match to d1pwba2 complexed with ca, gmh, k5b |
PDB Entry: 5oxr (more details), 1.75 Å
SCOPe Domain Sequences for d5oxrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oxrc1 h.1.1.1 (C:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]} aslrqqvealqgqvqhlqaafsqykkvelf
Timeline for d5oxrc1:
![]() Domains from other chains: (mouse over for more information) d5oxra1, d5oxra2, d5oxrb1, d5oxrb2 |