![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) ![]() duplication: contains two subdomains of this fold |
![]() | Family d.58.32.0: automated matches [227166] (1 protein) not a true family |
![]() | Protein automated matches [226875] (5 species) not a true protein |
![]() | Species Linum usitatissimum [TaxId:4006] [353683] (1 PDB entry) |
![]() | Domain d6c80b2: 6c80 B:245-532 [353728] Other proteins in same PDB: d6c80a1, d6c80b1 automated match to d4mlaa2 complexed with fad, gol, nh4, peg, pg6 |
PDB Entry: 6c80 (more details), 1.78 Å
SCOPe Domain Sequences for d6c80b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c80b2 d.58.32.0 (B:245-532) automated matches {Linum usitatissimum [TaxId: 4006]} pdmvrwirmvyaefedfsrdaewlvtqpekesfdyvegfafvnsdspadgwpsvplnhmm ttpihsghqllyclelalhfnhsnssstvdsvvkrligglrymkgfkyevdlsyvefvmr vkrveedarahgmwdaphpwlnlfvskadiaefdrlifkgllhdgvggpmlvypllrskw dsrssvvlpegedeifyivallrsnppypkgpsvdklvsqndkiiqsciqhglgfklylp hyqsqhdwrrhfgdqwskfvqlklafdpmavlapgqkiftrrtkkdpa
Timeline for d6c80b2: