Lineage for d6c80b2 (6c80 B:245-532)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562051Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2562158Family d.58.32.0: automated matches [227166] (1 protein)
    not a true family
  6. 2562159Protein automated matches [226875] (5 species)
    not a true protein
  7. 2562162Species Linum usitatissimum [TaxId:4006] [353683] (1 PDB entry)
  8. 2562164Domain d6c80b2: 6c80 B:245-532 [353728]
    Other proteins in same PDB: d6c80a1, d6c80b1
    automated match to d4mlaa2
    complexed with fad, gol, nh4, peg, pg6

Details for d6c80b2

PDB Entry: 6c80 (more details), 1.78 Å

PDB Description: crystal structure of a flax cytokinin oxidase
PDB Compounds: (B:) cytokinin oxidase LuCKX1.1

SCOPe Domain Sequences for d6c80b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c80b2 d.58.32.0 (B:245-532) automated matches {Linum usitatissimum [TaxId: 4006]}
pdmvrwirmvyaefedfsrdaewlvtqpekesfdyvegfafvnsdspadgwpsvplnhmm
ttpihsghqllyclelalhfnhsnssstvdsvvkrligglrymkgfkyevdlsyvefvmr
vkrveedarahgmwdaphpwlnlfvskadiaefdrlifkgllhdgvggpmlvypllrskw
dsrssvvlpegedeifyivallrsnppypkgpsvdklvsqndkiiqsciqhglgfklylp
hyqsqhdwrrhfgdqwskfvqlklafdpmavlapgqkiftrrtkkdpa

SCOPe Domain Coordinates for d6c80b2:

Click to download the PDB-style file with coordinates for d6c80b2.
(The format of our PDB-style files is described here.)

Timeline for d6c80b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6c80b1