SCOPe 2.07: Domain d6c80b2: 6c80 B:245-532

Lineage for d6c80b2 (6c80 B:245-532)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families)
   duplication: contains two subdomains of this fold

5. Family d.58.32.0: automated matches [227166] (1 protein)
   not a true family

6. Protein automated matches [226875] (5 species)
   not a true protein

7. Species Linum usitatissimum [TaxId:4006] [353683] (1 PDB entry)

8. Domain d6c80b2: 6c80 B:245-532 [353728]
   Other proteins in same PDB: d6c80a1, d6c80b1
   automated match to d4mlaa2
   complexed with fad, gol, nh4, peg, pg6

Details for d6c80b2

PDB Entry: 6c80, 1.78 Å

PDB Description: crystal structure of a flax cytokinin oxidase

PDB Compounds: (B:) cytokinin oxidase LuCKX1.1

SCOPe Domain Sequences for d6c80b2:

Sequence; same for both SEQRES and ATOM records:

>d6c80b2 d.58.32.0 (B:245-532) automated matches {Linum usitatissimum [TaxId: 4006]}
pdmvrwirmvyaefedfsrdaewlvtqpekesfdyvegfafvnsdspadgwpsvplnhmm
ttpihsghqllyclelalhfnhsnssstvdsvvkrligglrymkgfkyevdlsyvefvmr
vkrveedarahgmwdaphpwlnlfvskadiaefdrlifkgllhdgvggpmlvypllrskw
dsrssvvlpegedeifyivallrsnppypkgpsvdklvsqndkiiqsciqhglgfklylp
hyqsqhdwrrhfgdqwskfvqlklafdpmavlapgqkiftrrtkkdpa

Timeline for d6c80b2:

• d6c80b2 is new in SCOPe 2.07-stable
  
• d6c80b2 appears in the current release, SCOPe 2.08