Lineage for d5veta_ (5vet A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346280Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (39 PDB entries)
    Uniprot P59071
  8. 2346325Domain d5veta_: 5vet A: [353724]
    automated match to d1tk4a_

Details for d5veta_

PDB Entry: 5vet (more details), 2 Å

PDB Description: phospholipase a2, re-refinement of the pdb structure 1jq8 without the putative complexed oligopeptide
PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d5veta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5veta_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d5veta_:

Click to download the PDB-style file with coordinates for d5veta_.
(The format of our PDB-style files is described here.)

Timeline for d5veta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5vetb_