SCOPe 2.08: Domain d5veta_: 5vet A:

Lineage for d5veta_ (5vet A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (39 PDB entries)
   Uniprot P59071

8. Domain d5veta_: 5vet A: [353724]
   automated match to d1tk4a_

Details for d5veta_

PDB Entry: 5vet, 2 Å

PDB Description: phospholipase a2, re-refinement of the pdb structure 1jq8 without the putative complexed oligopeptide

PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d5veta_:

Sequence; same for both SEQRES and ATOM records:

>d5veta_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d5veta_:

• d5veta_ first appeared in SCOPe 2.07