SCOPe 2.07: Domain d5o7nb_: 5o7n B:

Lineage for d5o7nb_ (5o7n B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (12 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [271524] (10 PDB entries)

8. Domain d5o7nb_: 5o7n B: [353710]
   automated match to d5lsca_
   complexed with 9nk, edo, fmt, zn

Details for d5o7nb_

PDB Entry: 5o7n, 1.5 Å

PDB Description: beta-lactamase vim-2 in complex with (2r)-1-(2-benzyl-3- mercaptopropanoyl)piperidine-2-carboxylic acid

PDB Compounds: (B:) beta-lactamase vim-2

SCOPe Domain Sequences for d5o7nb_:

Sequence; same for both SEQRES and ATOM records:

>d5o7nb_ d.157.1.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs

Timeline for d5o7nb_:

• d5o7nb_ is new in SCOPe 2.07-stable
  
• d5o7nb_ appears in the current release, SCOPe 2.08