Lineage for d5o7nb_ (5o7n B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555488Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2555639Protein automated matches [190079] (12 species)
    not a true protein
  7. 2555679Species Klebsiella pneumoniae [TaxId:573] [271524] (10 PDB entries)
  8. 3053648Domain d5o7nb_: 5o7n B: [353710]
    automated match to d5lsca_
    complexed with 9nk, edo, fmt, zn

Details for d5o7nb_

PDB Entry: 5o7n (more details), 1.5 Å

PDB Description: beta-lactamase vim-2 in complex with (2r)-1-(2-benzyl-3- mercaptopropanoyl)piperidine-2-carboxylic acid
PDB Compounds: (B:) beta-lactamase vim-2

SCOPe Domain Sequences for d5o7nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o7nb_ d.157.1.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs

SCOPe Domain Coordinates for d5o7nb_:

Click to download the PDB-style file with coordinates for d5o7nb_.
(The format of our PDB-style files is described here.)

Timeline for d5o7nb_:

  • d5o7nb_ is new in SCOPe 2.07-stable