SCOPe 2.08: Domain d5ookb_: 5ook B:

Lineage for d5ookb_ (5ook B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (23 species)
   not a true protein

7. Species Acaryochloris marina [TaxId:155978] [353706] (1 PDB entry)

8. Domain d5ookb_: 5ook B: [353707]
   automated match to d4f0tb_
   complexed with cyc, peg

Details for d5ookb_

PDB Entry: 5ook, 2.1 Å

PDB Description: structure of a. marina phycocyanin contains overlapping isoforms

PDB Compounds: (B:) Phycocyanin, beta subunit

SCOPe Domain Sequences for d5ookb_:

Sequence; same for both SEQRES and ATOM records:

>d5ookb_ a.1.1.3 (B:) automated matches {Acaryochloris marina [TaxId: 155978]}
mldaftkvvsqadtrgayvsdaevdalkamvadankridavnritgnastivanaaralf
adqpqlcapggnaytsrrmaaclrdmeiilryvtyavytgdasvlndrclnglretysal
gvpggsvaagvqkmkeaaieiandpkgitqgdcsnlmaeigsyfdlassavg

Timeline for d5ookb_:

• d5ookb_ first appeared in SCOPe 2.07