Lineage for d6ghha_ (6ghh A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. Protein beta-Lactoglobulin [50827] (4 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [50828] (76 PDB entries)
    Uniprot P02754
  8. Domain d6ghha_: 6ghh A: [353702]
    automated match to d1bsqa_
    complexed with tda

Details for d6ghha_

PDB Entry: 6ghh (more details), 1.9 Å

PDB Description: thermodynamic, crystallographic and computational studies of non mammalian fatty acid binding to bovine b-lactoglobulin
PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d6ghha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ghha_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOPe Domain Coordinates for d6ghha_ are not available.

Timeline for d6ghha_: