Lineage for d1euhb_ (1euh B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140678Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species)
  7. 2140929Species Streptococcus mutans [TaxId:1309] [53729] (4 PDB entries)
  8. 2140931Domain d1euhb_: 1euh B: [35370]
    complexed with so4

Details for d1euhb_

PDB Entry: 1euh (more details), 1.82 Å

PDB Description: apo form of a nadp dependent aldehyde dehydrogenase from streptococcus mutans
PDB Compounds: (B:) nadp dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1euhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euhb_ c.82.1.1 (B:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]}
tkqyknyvngewklseneikiyepasgaelgsvpamsteevdyvyasakkaqpawralsy
ieraaylhkvadilmrdkekigailskevakgyksavsevvrtaeiinyaaeeglrmege
vleggsfeaaskkkiavvrrepvglvlaispfnypvnlagskiapaliagnviafkpptq
gsisglllaeafaeaglpagvfntitgrgseigdyivehqavnfinftgstgigerigkm
agmrpimlelggkdsaivledadleltakniiagafgysgqrctavkrvlvmesvadelv
ekirekvlaltignpeddaditplidtksadyveglindandkgatalteikregnlicp
ilfdkvttdmrlaweepfgpvlpiirvtsveeaieisnkseyglqasiftndfprafgia
eqlevgtvhinnktqrgtdnfpflgakksgagiqgvkysieamttvksvvfdik

SCOPe Domain Coordinates for d1euhb_:

Click to download the PDB-style file with coordinates for d1euhb_.
(The format of our PDB-style files is described here.)

Timeline for d1euhb_: