Lineage for d6en4d_ (6en4 D:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643807Fold g.101: Triquetra knot [345899] (1 superfamily)
    Triangular knot binding 3 zinc ions
  4. 2643808Superfamily g.101.1: Pre-mRNA splicing factor Phf5-like [345932] (1 family) (S)
    Pfam PF03660. Possible homology to LIM domains (57736) and to PHD domains (57911) discussed in PubMed 18621724
  5. 2643809Family g.101.1.1: Pre-mRNA splicing factor Phf5-like [345990] (1 protein)
  6. 2643810Protein Pre-mRNA splicing factor Phf5 / Rds3 [346131] (2 species)
  7. 2643814Species Human (Homo sapiens) [TaxId:9606] [346444] (4 PDB entries)
  8. 2643818Domain d6en4d_: 6en4 D: [353691]
    automated match to d5sybb_
    complexed with bgz, zn

Details for d6en4d_

PDB Entry: 6en4 (more details), 3.08 Å

PDB Description: sf3b core in complex with a splicing modulator
PDB Compounds: (D:) PHD finger-like domain-containing protein 5A

SCOPe Domain Sequences for d6en4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6en4d_ g.101.1.1 (D:) Pre-mRNA splicing factor Phf5 / Rds3 {Human (Homo sapiens) [TaxId: 9606]}
pdlifcrkqagvaigrlcekcdgkcvicdsyvrpctlvricdecnygsyqgrcvicggpg
vsdayyckectiqekdrdgcpkivnlgssktdl

SCOPe Domain Coordinates for d6en4d_:

Click to download the PDB-style file with coordinates for d6en4d_.
(The format of our PDB-style files is described here.)

Timeline for d6en4d_: