Class g: Small proteins [56992] (98 folds) |
Fold g.101: Triquetra knot [345899] (1 superfamily) Triangular knot binding 3 zinc ions |
Superfamily g.101.1: Pre-mRNA splicing factor Phf5-like [345932] (1 family) Pfam PF03660. Possible homology to LIM domains (57736) and to PHD domains (57911) discussed in PubMed 18621724 |
Family g.101.1.1: Pre-mRNA splicing factor Phf5-like [345990] (1 protein) |
Protein Pre-mRNA splicing factor Phf5 / Rds3 [346131] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [346444] (4 PDB entries) |
Domain d6en4d_: 6en4 D: [353691] automated match to d5sybb_ complexed with bgz, zn |
PDB Entry: 6en4 (more details), 3.08 Å
SCOPe Domain Sequences for d6en4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6en4d_ g.101.1.1 (D:) Pre-mRNA splicing factor Phf5 / Rds3 {Human (Homo sapiens) [TaxId: 9606]} pdlifcrkqagvaigrlcekcdgkcvicdsyvrpctlvricdecnygsyqgrcvicggpg vsdayyckectiqekdrdgcpkivnlgssktdl
Timeline for d6en4d_: