![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.0: automated matches [191624] (1 protein) not a true family |
![]() | Protein automated matches [191143] (12 species) not a true protein |
![]() | Species Linum usitatissimum [TaxId:4006] [353681] (1 PDB entry) |
![]() | Domain d6c80a1: 6c80 A:44-244 [353682] Other proteins in same PDB: d6c80a2, d6c80b2 automated match to d4mlaa1 complexed with fad, gol, nh4, peg, pg6 |
PDB Entry: 6c80 (more details), 1.78 Å
SCOPe Domain Sequences for d6c80a1:
Sequence, based on SEQRES records: (download)
>d6c80a1 d.145.1.0 (A:44-244) automated matches {Linum usitatissimum [TaxId: 4006]} sldlqgsidystlaagkdfggvyssnplalirpsgaddvarvlksacrssnltvaargng hsingqamadggivldmrstegnhfkilringgdhyadvsggalwedilmrcvseyglap rswtdylrltvggtlsnagvsgqafrygpqssnvteldvvtgkgdfltcsptqnsdlffg algglgqfgvitrariplepa
>d6c80a1 d.145.1.0 (A:44-244) automated matches {Linum usitatissimum [TaxId: 4006]} sldlqgsidystlaagkdfggvyssnplalirpsgaddvarvlksacrssnltvaargng hsingqamadggivldmrstegnhfkilrigdhyadvsggalwedilmrcvseyglaprs wtdylrltvggtlsnagvsgqafrygpqssnvteldvvtgkgdfltcsptqnsdlffgal gglgqfgvitrariplepa
Timeline for d6c80a1: