Lineage for d6c80a1 (6c80 A:44-244)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. Family d.145.1.0: automated matches [191624] (1 protein)
    not a true family
  6. Protein automated matches [191143] (12 species)
    not a true protein
  7. Species Flax (Linum usitatissimum) [TaxId:4006] [353681] (1 PDB entry)
  8. Domain d6c80a1: 6c80 A:44-244 [353682]
    Other proteins in same PDB: d6c80a2, d6c80b2
    automated match to d4mlaa1
    complexed with fad, gol, nh4, peg, pg6

Details for d6c80a1

PDB Entry: 6c80 (more details), 1.7800000000000002 Å

PDB Description: crystal structure of a flax cytokinin oxidase
PDB Compounds: (A:) cytokinin oxidase LuCKX1.1

SCOPe Domain Sequences for d6c80a1:

Sequence, based on SEQRES records: (download)

>d6c80a1 d.145.1.0 (A:44-244) automated matches {Flax (Linum usitatissimum) [TaxId: 4006]}
sldlqgsidystlaagkdfggvyssnplalirpsgaddvarvlksacrssnltvaargng
hsingqamadggivldmrstegnhfkilringgdhyadvsggalwedilmrcvseyglap
rswtdylrltvggtlsnagvsgqafrygpqssnvteldvvtgkgdfltcsptqnsdlffg
algglgqfgvitrariplepa

Sequence, based on observed residues (ATOM records): (download)

>d6c80a1 d.145.1.0 (A:44-244) automated matches {Flax (Linum usitatissimum) [TaxId: 4006]}
sldlqgsidystlaagkdfggvyssnplalirpsgaddvarvlksacrssnltvaargng
hsingqamadggivldmrstegnhfkilrigdhyadvsggalwedilmrcvseyglaprs
wtdylrltvggtlsnagvsgqafrygpqssnvteldvvtgkgdfltcsptqnsdlffgal
gglgqfgvitrariplepa

SCOPe Domain Coordinates for d6c80a1 are not available.

Timeline for d6c80a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6c80a2
View in 3D
Domains from other chains:
(mouse over for more information)
d6c80b1, d6c80b2