Lineage for d6f4ie_ (6f4i E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2558726Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2559203Protein automated matches [190332] (5 species)
    not a true protein
  7. 2559204Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [311207] (3 PDB entries)
  8. 2559211Domain d6f4ie_: 6f4i E: [353675]
    Other proteins in same PDB: d6f4id2
    automated match to d2fjja_

Details for d6f4ie_

PDB Entry: 6f4i (more details), 1.49 Å

PDB Description: crystal structure of drosophila melanogaster snf
PDB Compounds: (E:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d6f4ie_:

Sequence, based on SEQRES records: (download)

>d6f4ie_ d.58.7.1 (E:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktlkmrgqafvifkeigsas
nalrtmqgfpfydkpmqiaysksds

Sequence, based on observed residues (ATOM records): (download)

>d6f4ie_ d.58.7.1 (E:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktgqafvifkeigsasnalr
tmqgfpfydkpmqiaysksds

SCOPe Domain Coordinates for d6f4ie_:

Click to download the PDB-style file with coordinates for d6f4ie_.
(The format of our PDB-style files is described here.)

Timeline for d6f4ie_: