![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein automated matches [190332] (5 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [311207] (3 PDB entries) |
![]() | Domain d6f4ia_: 6f4i A: [353672] Other proteins in same PDB: d6f4id2 automated match to d2fjja_ |
PDB Entry: 6f4i (more details), 1.49 Å
SCOPe Domain Sequences for d6f4ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f4ia_ d.58.7.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} mlpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktlkmrgqafvifkeigsa snalrtmqgfpfydkpmqiaysksdsdivaki
Timeline for d6f4ia_: