Class a: All alpha proteins [46456] (290 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) |
Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins) automatically mapped to Pfam PF02216 |
Protein automated matches [191290] (5 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [189943] (16 PDB entries) |
Domain d6fgof_: 6fgo F: [353670] automated match to d2spza_ complexed with ca, cl, gol, peg |
PDB Entry: 6fgo (more details), 2.5 Å
SCOPe Domain Sequences for d6fgof_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fgof_ a.8.1.1 (F:) automated matches {Staphylococcus aureus [TaxId: 1280]} vdnklnkeqqnafyeilhlpnlneeqrkafiqslidgggdtngngyldaeesanllaeak klndara
Timeline for d6fgof_: