Lineage for d6cz3a_ (6cz3 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2984910Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)
  8. 2985392Domain d6cz3a_: 6cz3 A: [353654]
    automated match to d2j0la_
    complexed with act, flj, k

Details for d6cz3a_

PDB Entry: 6cz3 (more details), 1.8 Å

PDB Description: structure of the ptk6 kinase domain bound to a type i inhibitor (3- fluoro-4-{[6-methyl-3-(1h-pyrazol-4-yl)imidazo[1,2-a]pyrazin-8- yl]amino}phenyl)(morpholin-4-yl)methanone
PDB Compounds: (A:) Protein-tyrosine kinase 6

SCOPe Domain Sequences for d6cz3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cz3a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddaerpreeftlcrklgsgyfgevfeglwkdrvqvaikvisrdnllhqqmlqseiqamkk
lrhkhilalyavvsvgdpvyiitelmakgsllellrdsdekvlpvselldiawqvaegmc
ylesqnyihrdlaarnilvgentlckvgdfglarlikedvylshdhnipykwtapealsr
ghystksdvwsfgillhemfsrgqvpypgmsnheaflrvdagyrmpcplecppsvhklml
tcwcrdpeqrpcfkalrerlss

SCOPe Domain Coordinates for d6cz3a_:

Click to download the PDB-style file with coordinates for d6cz3a_.
(The format of our PDB-style files is described here.)

Timeline for d6cz3a_: