Lineage for d6bpdb2 (6bpd B:133-236)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. Domain d6bpdb2: 6bpd B:133-236 [353650]
    automated match to d1tqbc2

Details for d6bpdb2

PDB Entry: 6bpd (more details), 2.32 Å

PDB Description: plasmodium vivax invasion blocking monoclonal antibody 10b12
PDB Compounds: (B:) Monoclonal antibody 10B12 Fab light chain

SCOPe Domain Sequences for d6bpdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bpdb2 b.1.1.0 (B:133-236) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d6bpdb2 are not available.

Timeline for d6bpdb2:

Domains from same chain:
(mouse over for more information)
d6bpdb1
Domains from other chains:
(mouse over for more information)
d6bpda_