Lineage for d6c08b1 (6c08 B:1-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761307Domain d6c08b1: 6c08 B:1-110 [353642]
    automated match to d4jr9l1
    complexed with arg

Details for d6c08b1

PDB Entry: 6c08 (more details), 3.17 Å

PDB Description: zebrafish slc38a9 with arginine bound in the cytosol open state
PDB Compounds: (B:) antibody fab light chain

SCOPe Domain Sequences for d6c08b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c08b1 b.1.1.0 (B:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspsslsvvvgfyvtitsqasnnittyssfifwyqqkpgqapklliydsstlesg
ipgrfsgsgsgrdfsltigpnqpadgatyedlqyngevrtfgggtkleik

SCOPe Domain Coordinates for d6c08b1:

Click to download the PDB-style file with coordinates for d6c08b1.
(The format of our PDB-style files is described here.)

Timeline for d6c08b1: