Lineage for d6a12a_ (6a12 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
    lack the first two strands of the common fold
  6. Protein Lipase A [64145] (4 species)
    minimal alpha/beta hydrolase fold;
  7. Species Geobacillus thermoleovorans [TaxId:33941] [419778] (1 PDB entry)
  8. Domain d6a12a_: 6a12 A: [353637]
    automated match to d1ku0a_
    complexed with ca, zn

Details for d6a12a_

PDB Entry: 6a12 (more details), 2.15 Å

PDB Description: x-ray structure of lipase from geobacillus thermoleovorans
PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d6a12a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a12a_ c.69.1.18 (A:) Lipase A {Geobacillus thermoleovorans [TaxId: 33941]}
srandapivllhgftgwgreemfgfkywggvrgdieqwlndngyrtytlavgplssnwdr
aceayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrihiiahsqggqtarml
vsllengsqeereyakahnvslsplfegghhfvlsvttiatphdgttlvnmvdftdrffd
lqkavleaaavasnapytseiydfkldqwglrrepgesfdhyferlkrspvwtstdtary
dlsvpgaetlnrwvkaspntyylsfstertyrgaltgnyypelgmnafsaivcapflgsy
rnaalgidshwlendgivntismngpkrgssdrivpydgalkkgvwndmgtynvdhleii
gvdpnpsfdirafylrlaeqlaslrp

SCOPe Domain Coordinates for d6a12a_ are not available.

Timeline for d6a12a_: