Lineage for d1a4sb_ (1a4s B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27618Fold c.82: Aldehyde reductase (dehydrogenase), ALDH [53719] (1 superfamily)
  4. 27619Superfamily c.82.1: Aldehyde reductase (dehydrogenase), ALDH [53720] (1 family) (S)
  5. 27620Family c.82.1.1: Aldehyde reductase (dehydrogenase), ALDH [53721] (1 protein)
  6. 27621Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (8 species)
  7. 27622Species Baltic cod (Gadus callarias) [TaxId:8053] [53728] (2 PDB entries)
  8. 27624Domain d1a4sb_: 1a4s B: [35362]

Details for d1a4sb_

PDB Entry: 1a4s (more details), 2.1 Å

PDB Description: betaine aldehyde dehydrogenase from cod liver

SCOP Domain Sequences for d1a4sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4sb_ c.82.1.1 (B:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias)}
aqlvdsmpsastgsvvvtddlnywggrrikskdgattepvfepatgrvlcqmvpcgaeev
dqavqsaqaaylkwskmagiersrvmleaariirerrdniaklevinngktiteaeydid
aawqcieyyaglaptlsgqhiqlpggafaytrreplgvcagilawnypfmiaawkcapal
acgnavvfkpspmtpvtgvilaeifheagvpvglvnvvqggaetgsllchhpnvakvsft
gsvptgkkvmemsaktvkhvtlelggkspllifkdcelenavrgalmanfltqgqvctng
trvfvqreimpqfleevvkrtkaivvgdplltetrmggliskpqldkvlgfvaqakkega
rvlcggepltpsdpklkngyfmspcvldncrddmtcvkeeifgpvmsvlpfdteeevlqr
annttfglasgvftrdisrahrvaanleagtcyintysispvevpfggykmsgfgrengq
atvdyysqlktvivemgdvdslf

SCOP Domain Coordinates for d1a4sb_:

Click to download the PDB-style file with coordinates for d1a4sb_.
(The format of our PDB-style files is described here.)

Timeline for d1a4sb_: