Lineage for d5xr7b_ (5xr7 B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. Protein automated matches [190123] (156 species)
    not a true protein
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (8 PDB entries)
  8. Domain d5xr7b_: 5xr7 B: [353614]
    automated match to d1doaa_
    complexed with gtp, mg

Details for d5xr7b_

PDB Entry: 5xr7 (more details), 2.6 Å

PDB Description: crystal structure of raba1a (q72k) in complex with gtp
PDB Compounds: (B:) Ras-related protein RABA1a

SCOPe Domain Sequences for d5xr7b_:

Sequence, based on SEQRES records: (download)

>d5xr7b_ c.37.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dylfklvligdsgvgksnllsrftknefnleskstigvefatkttkvegkvvkaqiwdta
gkeryraitsayyrgavgalliydvtrhatfenaarwlrelrghtdpnivvmlignkcdl
rhlvavkteeakafaereslyfmetsaldatnvenaftevltqihkivs

Sequence, based on observed residues (ATOM records): (download)

>d5xr7b_ c.37.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dylfklvligdsgvgksnllsrftknefnleskstigvefatkttkvegkvvkaqiwdta
gkraitsayyrgavgalliydvtrhatfenaarwlrelrghtdpnivvmlignkcdlrhl
vavkteeakafaereslyfmetsaldatnvenaftevltqihkivs

SCOPe Domain Coordinates for d5xr7b_ are not available.

Timeline for d5xr7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5xr7a_