SCOPe 2.08: Domain d5zwpb1: 5zwp B:1-84

Lineage for d5zwpb1 (5zwp B:1-84)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species House fly (Musca domestica) [TaxId:7370] [226605] (2 PDB entries)

8. Domain d5zwpb1: 5zwp B:1-84 [353602]
   Other proteins in same PDB: d5zwpa2, d5zwpb2
   automated match to d3eina1
   complexed with fmt, gsh

Details for d5zwpb1

PDB Entry: 5zwp, 1.4 Å

PDB Description: crystal structure of the delta-class glutathione transferase from musca domestica

PDB Compounds: (B:) Glutathione S-transferase 1

SCOPe Domain Sequences for d5zwpb1:

Sequence; same for both SEQRES and ATOM records:

>d5zwpb1 c.47.1.0 (B:1-84) automated matches {House fly (Musca domestica) [TaxId: 7370]}
mdfyylpgsapcrsvlmtakalgielnkkllnlqagehlkpeflkinpqhtiptlvdgdf
alwesraimvylvekygktdslfp

Timeline for d5zwpb1:

• d5zwpb1 first appeared in SCOPe 2.07