Lineage for d5zwpa2 (5zwp A:85-207)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2326952Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2326953Protein automated matches [226831] (71 species)
    not a true protein
  7. 2327156Species House fly (Musca domestica) [TaxId:7370] [226606] (2 PDB entries)
  8. 2327161Domain d5zwpa2: 5zwp A:85-207 [353594]
    Other proteins in same PDB: d5zwpa1, d5zwpb1
    automated match to d3eina2
    complexed with fmt, gsh

Details for d5zwpa2

PDB Entry: 5zwp (more details), 1.4 Å

PDB Description: crystal structure of the delta-class glutathione transferase from musca domestica
PDB Compounds: (A:) Glutathione S-transferase 1

SCOPe Domain Sequences for d5zwpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zwpa2 a.45.1.0 (A:85-207) automated matches {House fly (Musca domestica) [TaxId: 7370]}
kcpkkravinqrlyfdmgtlyksfadyyypqifakapadpelfkkietafdflntflkgh
eyaagdsltvadlallasvstfevasfdiskypnvakwyanlktvapgweenwagclefk
kyf

SCOPe Domain Coordinates for d5zwpa2:

Click to download the PDB-style file with coordinates for d5zwpa2.
(The format of our PDB-style files is described here.)

Timeline for d5zwpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zwpa1