Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species House fly (Musca domestica) [TaxId:7370] [226605] (2 PDB entries) |
Domain d5zwpa1: 5zwp A:1-84 [353593] Other proteins in same PDB: d5zwpa2, d5zwpb2 automated match to d3eina1 complexed with fmt, gsh |
PDB Entry: 5zwp (more details), 1.4 Å
SCOPe Domain Sequences for d5zwpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zwpa1 c.47.1.0 (A:1-84) automated matches {House fly (Musca domestica) [TaxId: 7370]} mdfyylpgsapcrsvlmtakalgielnkkllnlqagehlkpeflkinpqhtiptlvdgdf alwesraimvylvekygktdslfp
Timeline for d5zwpa1: