Lineage for d5zwpa1 (5zwp A:1-84)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879604Species House fly (Musca domestica) [TaxId:7370] [226605] (2 PDB entries)
  8. 2879609Domain d5zwpa1: 5zwp A:1-84 [353593]
    Other proteins in same PDB: d5zwpa2, d5zwpb2
    automated match to d3eina1
    complexed with fmt, gsh

Details for d5zwpa1

PDB Entry: 5zwp (more details), 1.4 Å

PDB Description: crystal structure of the delta-class glutathione transferase from musca domestica
PDB Compounds: (A:) Glutathione S-transferase 1

SCOPe Domain Sequences for d5zwpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zwpa1 c.47.1.0 (A:1-84) automated matches {House fly (Musca domestica) [TaxId: 7370]}
mdfyylpgsapcrsvlmtakalgielnkkllnlqagehlkpeflkinpqhtiptlvdgdf
alwesraimvylvekygktdslfp

SCOPe Domain Coordinates for d5zwpa1:

Click to download the PDB-style file with coordinates for d5zwpa1.
(The format of our PDB-style files is described here.)

Timeline for d5zwpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zwpa2