Lineage for d5o5aa_ (5o5a A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. Protein automated matches [190615] (14 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1029 PDB entries)
  8. Domain d5o5aa_: 5o5a A: [353590]
    automated match to d5myga_
    protein/DNA complex; complexed with 9ln, no3

Details for d5o5aa_

PDB Entry: 5o5a (more details), 1.6 Å

PDB Description: crystal structure of the human brpf1 bromodomain in complex with bz032
PDB Compounds: (A:) Peregrin

SCOPe Domain Sequences for d5o5aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o5aa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayr
ylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekm

SCOPe Domain Coordinates for d5o5aa_ are not available.

Timeline for d5o5aa_: